Loading...
Statistics
Advertisement

Nelson Clean Care For a Cleaner, Healthier Home
www.nelsoncleancare.com/
Integrity and honesty are our foundation. Our years of experience equip us to guide our customers through a potentially emotional and crisis driven experience.

Nelsoncleancare.com

Advertisement
Conversion Technology Metas Server
Nelsoncleancare.com is hosted in United States / Brea . Nelsoncleancare.com doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Html, Number of used javascripts: 7. First javascripts: Jquery.js, Ccm.base.js, Superfish.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Nelsoncleancare.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Html
  • Javascript
  • jQuery
  • Php
  • SuperFish
  • Swf Object

Advertisement

Javascripts

Number of occurences: 7
  • jquery.js
  • ccm.base.js
  • superfish.js
  • swfobject.js
  • homepage.font.js
  • jquery.msAccordion.js
  • selectivizr.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Nelsoncleancare.com

Missing HTTPS protocol.

    Meta - Nelsoncleancare.com

    Number of occurences: 4
    • Name:
      Content: text/html; charset=UTF-8
    • Name: description
      Content: Integrity and honesty are our foundation. Our years of experience equip us to guide our customers through a potentially emotional and crisis driven experience.
    • Name: keywords
      Content: Carpet Cleaning Services, carpet, carpet cleaning, carpet and upholstery Emergency Services, emergency, 24/7, Mold Remediation, mold, microbial, mold removal waukesha, Cleaner, Healthier Home Exceptional service, Integrity, Honesty, Waukesha, Indoor Environment, Residential, Commercial, Referral Program, guarantee
    • Name: generator
      Content: concrete5 - 5.6.3.4

    Server / Hosting

    • IP: 208.113.220.78
    • Latitude: 33.93
    • Longitude: -117.86
    • Country: United States
    • City: Brea

    Rname

    • ns1.dreamhost.com
    • ns2.dreamhost.com
    • ns3.dreamhost.com
    • ALT2.ASPMX.L.GOOGLE.com
    • ASPMX.L.GOOGLE.com
    • ASPMX5.GOOGLEMAIL.com
    • ASPMX2.GOOGLEMAIL.com
    • ALT1.ASPMX.L.GOOGLE.com
    • ASPMX4.GOOGLEMAIL.com
    • ASPMX3.GOOGLEMAIL.com

    Target

    • hostmaster.dreamhost.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sun, 01 May 2016 09:19:23 GMT Server: Apache Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: CONCRETE5=J3ZOwoP3OrMLJZfF9bk3f0; path=/; HttpOnly Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8

    DNS

    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 1569
    3. type: A
    4. ip: 208.113.220.78
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns1.dreamhost.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns2.dreamhost.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns3.dreamhost.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: SOA
    4. mname: ns1.dreamhost.com
    5. rname: hostmaster.dreamhost.com
    6. serial: 2014020600
    7. refresh: 17264
    8. retry: 1800
    9. expire: 1814400
    10. minimum-ttl: 14400
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 20
    5. target: ALT2.ASPMX.L.GOOGLE.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 10
    5. target: ASPMX.L.GOOGLE.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 30
    5. target: ASPMX5.GOOGLEMAIL.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 30
    5. target: ASPMX2.GOOGLEMAIL.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 20
    5. target: ALT1.ASPMX.L.GOOGLE.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 30
    5. target: ASPMX4.GOOGLEMAIL.com
    host: nelsoncleancare.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 30
    5. target: ASPMX3.GOOGLEMAIL.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.elsoncleancare.com, www.nnelsoncleancare.com, www.nelsoncleancare.com, www.nhelsoncleancare.com, www.helsoncleancare.com, www.njelsoncleancare.com, www.jelsoncleancare.com, www.nkelsoncleancare.com, www.kelsoncleancare.com, www.nlelsoncleancare.com, www.lelsoncleancare.com, www.n elsoncleancare.com, www. elsoncleancare.com, www.nlsoncleancare.com, www.nexlsoncleancare.com, www.nxlsoncleancare.com, www.neslsoncleancare.com, www.nslsoncleancare.com, www.newlsoncleancare.com, www.nwlsoncleancare.com, www.nerlsoncleancare.com, www.nrlsoncleancare.com, www.neflsoncleancare.com, www.nflsoncleancare.com, www.nevlsoncleancare.com, www.nvlsoncleancare.com, www.neclsoncleancare.com, www.nclsoncleancare.com, www.neqlsoncleancare.com, www.nqlsoncleancare.com, www.nealsoncleancare.com, www.nalsoncleancare.com, www.neylsoncleancare.com, www.nylsoncleancare.com, www.nesoncleancare.com, www.nelusoncleancare.com, www.neusoncleancare.com, www.nel8soncleancare.com, www.ne8soncleancare.com, www.nel9soncleancare.com, www.ne9soncleancare.com, www.neljsoncleancare.com, www.nejsoncleancare.com, www.nel0soncleancare.com, www.ne0soncleancare.com, www.nelmsoncleancare.com, www.nemsoncleancare.com, www.nelpsoncleancare.com, www.nepsoncleancare.com, www.nelosoncleancare.com, www.neosoncleancare.com, www.neloncleancare.com, www.nelseoncleancare.com, www.neleoncleancare.com, www.nelswoncleancare.com, www.nelwoncleancare.com, www.nelsdoncleancare.com, www.neldoncleancare.com, www.nelsxoncleancare.com, www.nelxoncleancare.com, www.nelsfoncleancare.com, www.nelfoncleancare.com, www.nelsgoncleancare.com, www.nelgoncleancare.com, www.nelstoncleancare.com, www.neltoncleancare.com, www.nelsncleancare.com, www.nelsobncleancare.com, www.nelsbncleancare.com, www.nelsohncleancare.com, www.nelshncleancare.com, www.nelsogncleancare.com, www.nelsgncleancare.com, www.nelsojncleancare.com, www.nelsjncleancare.com, www.nelsomncleancare.com, www.nelsmncleancare.com, www.nelso ncleancare.com, www.nels ncleancare.com, www.nelsovncleancare.com, www.nelsvncleancare.com, www.nelsocleancare.com, www.nelsonncleancare.com, www.nelsoncleancare.com, www.nelsonhcleancare.com, www.nelsohcleancare.com, www.nelsonjcleancare.com, www.nelsojcleancare.com, www.nelsonkcleancare.com, www.nelsokcleancare.com, www.nelsonlcleancare.com, www.nelsolcleancare.com, www.nelson cleancare.com, www.nelso cleancare.com, www.nelsonleancare.com, www.nelsoncdleancare.com, www.nelsondleancare.com, www.nelsoncrleancare.com, www.nelsonrleancare.com, www.nelsonctleancare.com, www.nelsontleancare.com, www.nelsoncvleancare.com, www.nelsonvleancare.com, www.nelsoncfleancare.com, www.nelsonfleancare.com, www.nelsoncgleancare.com, www.nelsongleancare.com, www.nelsonchleancare.com, www.nelsonhleancare.com, www.nelsoncnleancare.com, www.nelsonnleancare.com, www.nelsoncmleancare.com, www.nelsonmleancare.com, www.nelsoncjleancare.com, www.nelsonjleancare.com, www.nelsonceancare.com, www.nelsonclueancare.com, www.nelsoncueancare.com, www.nelsoncl8eancare.com, www.nelsonc8eancare.com, www.nelsoncl9eancare.com, www.nelsonc9eancare.com, www.nelsoncljeancare.com, www.nelsoncjeancare.com, www.nelsoncl0eancare.com, www.nelsonc0eancare.com, www.nelsonclmeancare.com, www.nelsoncmeancare.com, www.nelsonclpeancare.com, www.nelsoncpeancare.com, www.nelsoncloeancare.com, www.nelsoncoeancare.com, www.nelsonclancare.com, www.nelsonclexancare.com, www.nelsonclxancare.com, www.nelsonclesancare.com, www.nelsonclsancare.com, www.nelsonclewancare.com, www.nelsonclwancare.com, www.nelsonclerancare.com, www.nelsonclrancare.com, www.nelsonclefancare.com, www.nelsonclfancare.com, www.nelsonclevancare.com, www.nelsonclvancare.com, www.nelsonclecancare.com, www.nelsonclcancare.com, www.nelsoncleqancare.com, www.nelsonclqancare.com, www.nelsoncleaancare.com, www.nelsonclaancare.com, www.nelsoncleyancare.com, www.nelsonclyancare.com, www.nelsonclencare.com, www.nelsoncleaoncare.com, www.nelsoncleoncare.com, www.nelsoncleapncare.com, www.nelsonclepncare.com, www.nelsonclea9ncare.com, www.nelsoncle9ncare.com, www.nelsoncleancare.com, www.nelsonclencare.com, www.nelsoncleaincare.com, www.nelsoncleincare.com, www.nelsoncleauncare.com, www.nelsoncleuncare.com,

    Other websites we recently analyzed

    1. minipli.net
      Germany - 144.76.92.157
      Server software: Apache
      Technology: Html
    2. Yes You Can Recipes
      Recipes and tips for pre-diabetic and diabetic cookery
      Canada - 174.142.40.130
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript
      Number of Javascript: 4
      Number of meta tags: 3
    3. nancykhawamfamilylawandmediation.org
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    4. Home - RSM Connect - Breitband für das Berchtesgadener Land und Landkreis Traunstein
      Germany - 80.255.15.136
      Server software: Apache/2.2.15 (Unix) DAV/2 mod_fcgid/2.3.6-dev SVN/1.6.11
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 4
      Number of meta tags: 3
    5. Immobilier Dompierrois
      France - 195.154.216.236
      Server software: Apache/2.4.9 (Win64) PHP/5.5.12
      Technology: CSS, Google Font API, Html, Iframe, Javascript, Php, Swf Object, Google Analytics
      Number of Javascript: 1
      Number of meta tags: 1
    6. PSD to Responsive HTML5 & CSS - Slice PSD - Save 40% on every order
      Pixel perfect PSD to HTML5 and CSS converting services: PSD to Email, WordPress, Magento, global coding standards, world class quality at great prices. Full money back guarantee.
      Lansing (United States) - 50.28.14.165
      G Analytics ID: UA-55736473-1
      Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: CSS, Html, Html5, Javascript, SuperFish, Zopim Live Chat, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 4
    7. BM Scavi
      Arezzo (Italy) - 62.149.144.108
      G Analytics ID: UA-65976169-1
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Javascript, jQuery, jQuery Fancybox, Php, Pingback, SVG, Google Analytics, Wordpress
      Number of Javascript: 11
      Number of meta tags: 4
    8. Ear Mitts Ear Muffs - Bandless Ear Muffs Ear Warmers
      Earz and Ear Mitts Bandless Ear Muffs area stylish way to keep your ears protected from the wind and cold. Their unique patented design works for anyone. ONE SIZE FITS ALL! A perfect gift idea!
      Frisco (United States) - 64.251.203.56
      G Analytics ID: UA-42780856-1
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Javascript, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 4
    9. ### Sanitätshaus Koeppe, Wald-Apotheke, Westend-Apotheke Eberswalde ###
      Die Wald-Apotheke, Westend-Apotheke und das Sanitätshaus Koeppe versorgen Pflegeeinrichtungen, Krankenhäuser und Arztpraxen mit Medikamenten und medizinischem Bedarf. Wir liefern innerhalb Eberswalde kostenlos zu Ihnen.
      Germany - 217.160.123.26
      Server software: Apache
      Technology: CSS, Php
      Number of meta tags: 7
    10. zzhy888.com
      San Jose (United States) - 69.46.84.52
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1

    Check Other Websites